General Information

  • ID:  hor000476
  • Uniprot ID:  A0A6J1WKA0
  • Protein name:  Hea-AST-7
  • Gene name:  LOC113512098
  • Organism:  Galleria mellonella (Greater wax moth)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Galleria (genus), Galleriinae (subfamily), Pyralidae (family), Pyraloidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SRPYSFGL
  • Length:  8(82-89)
  • Propeptide:  MLYSSLPVCLLLIGVAFCAPEQIQSEPETPTHEDPSTNNIEYTASLEKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQISEFNNDVDQTDLAAFLDQYDDAPVYEEKRARPYSFGLGKRNAENDISEEKRGRMYDFGLGKRLPMYSFGLGKRARSYNFGLGKRLSSKFNFGLGKRERDLHRFNFGLGKRSADDTSNDDSVNYFDV
  • Signal peptide:  MLYSSLPVCLLLIGVAFC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6J1WKA0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000476_AF2.pdbhor000476_ESM.pdb

Physical Information

Mass: 105106 Formula: C43H63N11O12
Absent amino acids: ACDEHIKMNQTVW Common amino acids: S
pI: 9.35 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -35 Boman Index: -1302
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 5690 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  15706623
  • Title:  Mass Spectrometric Analysis of Head Ganglia and Neuroendocrine Tissue of Larval Galleria Mellonella (Arthropoda, Insecta)